PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0424s0220.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NF-YB
Protein Properties Length: 147aa    MW: 16320.1 Da    PI: 5.324
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0424s0220.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB162.36.9e-51498397
                   NF-YB  3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91
                            eqdr+lPianv+r+mk++lP  akisk+ak+t+qec++efisfvt+easdkcq+e+rkt+ngdd++wal++lGf+dy+e++  yl+kyr
  SapurV1A.0424s0220.1.p  4 EQDRLLPIANVGRMMKQTLPPTAKISKEAKQTMQECATEFISFVTGEASDKCQKENRKTVNGDDICWALSSLGFDDYAEAIVRYLHKYR 92
                            8**************************************************************************************** PP

                   NF-YB 92 elegek 97
                            e+e+e+
  SapurV1A.0424s0220.1.p 93 EAERER 98
                            ***997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.2E-513123IPR009072Histone-fold
SuperFamilySSF471132.1E-395122IPR009072Histone-fold
PfamPF008081.2E-26872IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.0E-173654No hitNo description
PROSITE patternPS0068503955IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.0E-175573No hitNo description
PRINTSPR006151.0E-177492No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 147 aa     Download sequence    Send to blast
MDGEQDRLLP IANVGRMMKQ TLPPTAKISK EAKQTMQECA TEFISFVTGE ASDKCQKENR  60
KTVNGDDICW ALSSLGFDDY AEAIVRYLHK YREAERERSA NQHEASGTDR GEESNHESKQ  120
PVFKVPGGLE FRVLDKGSSS SFTNPS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B4e-42493392Transcription factor HapC (Eurofung)
4g92_B4e-42493392Transcription factor HapC (Eurofung)
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00133DAPTransfer from AT1G09030Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011036836.13e-91PREDICTED: nuclear transcription factor Y subunit B-4-like
SwissprotO040276e-59NFYB4_ARATH; Nuclear transcription factor Y subunit B-4
TrEMBLB9N4G44e-91B9N4G4_POPTR; Uncharacterized protein
STRINGPOPTR_0005s02750.11e-90(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80532131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09030.14e-60nuclear factor Y, subunit B4